PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000132671
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 388aa    MW: 43582.4 Da    PI: 6.0599
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000132671genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.75.4e-081550136
                     TSSS-HHHHHHHHHHHHH.TTTT-HHHHHHHHTTTS- CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkq.lGggtWktIartmgkgRt 36
                     +g+W++eEdell++++ + +G g+W++ ++    +R+
    MDP0000132671 15 KGPWSPEEDELLLNYISKnHGHGSWRSLPKLAE-NRC 50
                     79**************7637777********99.998 PP

2Myb_DNA-binding49.31.1e-15106151148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++l+++++ +lG++ W+tIa+ ++ gRt++++k+ w+++l
    MDP0000132671 106 RGPFSKDEEKLIIQLHGMLGNR-WATIASQLP-GRTDNEIKNLWNTHL 151
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-20746IPR009057Homeodomain-like
SuperFamilySSF466893.14E-61050IPR009057Homeodomain-like
PROSITE profilePS512949.1641067IPR017930Myb domain
SMARTSM007170.002114102IPR001005SANT/Myb domain
PfamPF002491.5E-61550IPR001005SANT/Myb domain
CDDcd001675.47E-51750No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2083103IPR009057Homeodomain-like
SuperFamilySSF466891.33E-2186156IPR009057Homeodomain-like
PROSITE profilePS5129425.134101155IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-25104155IPR009057Homeodomain-like
SMARTSM007173.1E-14105153IPR001005SANT/Myb domain
PfamPF002492.1E-14106151IPR001005SANT/Myb domain
CDDcd001673.24E-10108151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGRTPCCDNK KDLKKGPWSP EEDELLLNYI SKNHGHGSWR SLPKLAENRC IXVLIFLGYY  60
GLKHPRXWEN SCYPIXHGLL FPIGLQRCGK SCRLRWTNYL KPDIKRGPFS KDEEKLIIQL  120
HGMLGNRWAT IASQLPGRTD NEIKNLWNTH LRKGLVSMGI DPQTHEPLSS NCLSNXASAS  180
AATRHMAQWE SARLEAEARL SRDSSLFSRV PEKSESDHFL RLWNSEVGKS FRKLSTSDKF  240
ACQSPISQAS SSTKCGSLSA VTTEVGNLTG SSTMAGNXNE DLIYRPFLIN TEDVEYKPFQ  300
FNTEEVGYKP FQSXTEEVEF KICQSNTEDV MAGSVSSCSN DLEDSSDTAL QLLLDYPTND  360
DMSFLENNAN DYATTPAELT PNSFICPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-211215324126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159950.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744650.0DQ074465.1 Malus x domestica MYB14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008353981.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLQ2LME70.0Q2LME7_MALDO; MYB14
STRINGPOPTR_0014s07700.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-106myb domain protein 17